PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013602193.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 267aa    MW: 30464 Da    PI: 6.5107
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013602193.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
   XP_013602193.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding46.58.6e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
   XP_013602193.1  67 RGNFTPHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.363965IPR017930Myb domain
SuperFamilySSF466899.54E-3111108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002492.3E-161461IPR001005SANT/Myb domain
CDDcd001671.00E-101661No hitNo description
Gene3DG3DSA:1.10.10.608.1E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129419.23966116IPR017930Myb domain
SMARTSM007174.2E-1366114IPR001005SANT/Myb domain
PfamPF002494.0E-1367112IPR001005SANT/Myb domain
CDDcd001671.12E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRPPCCDKI RIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA SIASYLPQRT DNDIKNYWNT HLKKKLNKSE  120
SEERSISENI TLQTSATRNA INHRSTYASS TENISRLLEG WMRASPKSST ASFLEQKVQN  180
RTNDLMDHHN DESPYEQGSW DQGFHVHPKK SEENVKCDHD VQEDGDGDGD GDATPPLTFI  240
EKWLLEETNT GGQMEVMSPL MELSNML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628950.0AF062895.1 Arabidopsis thaliana putative transcription factor (MYB60) mRNA, complete cds.
GenBankAK1174690.0AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBankAY5195510.0AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBankBT0050740.0BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602193.10.0PREDICTED: myb-related protein 306-like
RefseqXP_013750898.10.0PREDICTED: myb-related protein 306-like
SwissprotQ9SCU74e-85MYB30_ARATH; Transcription factor MYB30
TrEMBLA0A078H0C90.0A0A078H0C9_BRANA; BnaCnng06440D protein
TrEMBLA0A0D3DNI60.0A0A0D3DNI6_BRAOL; Uncharacterized protein
STRINGBra030743.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-142myb domain protein 60